PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr019785.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRF
Protein Properties Length: 582aa    MW: 62543 Da    PI: 8.5736
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr019785.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.43e-24206250145
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                  d+epgrCrRtDGKkWRC+r++++++k+CErH++rgr+rsrk++e 
  Pbr019785.1 206 DPEPGRCRRTDGKKWRCWRDAVPDQKYCERHMNRGRHRSRKPVEG 250
                  79****************************************985 PP

2QLQ61.42.4e-21136172137
          QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                  ++FT++Q+++L++Q+l+yKy+ an+P+P+ Ll++i+k
  Pbr019785.1 136 GPFTPSQWMELEHQALIYKYITANMPIPSTLLAPIKK 172
                  59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.3E-13136172IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.0E-15137170IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.433137172IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.916206250IPR014977WRC domain
PfamPF088792.7E-20207249IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    Send to blast
MDLGVVGFGG LGGGCSSDSG FPLAATSSAD QEAAKHKWLY GSGYHRQWRS ADEEDWRSSK  60
LAKTDDFSSS NAMQQQQSLS FSNSPNPEAV LVEKNAAMPY FHQALPAYNR TSAGHNSGSL  120
SNGAAAMHWS TAGGRGPFTP SQWMELEHQA LIYKYITANM PIPSTLLAPI KKALDSAGFS  180
TFPNGLLRPN SLGWGSIHLG FSNNTDPEPG RCRRTDGKKW RCWRDAVPDQ KYCERHMNRG  240
RHRSRKPVEG QTGHTGTTTS KQPLASSSST SVVSIPGGDG GGSSSHAIAN QQLKSLQQPA  300
ASNSSAAATQ MNRMFMNKEN AGGRIQHTPG LTMLSKENPF STQKQQIGCE ESSRTEFGLV  360
SSDSLLNPSQ KRSYPAETNS QQHSLRHFID DWPKTQSDRQ PVSWPNQLGM QSDRTQLSIS  420
IPIASSTSSE KLTLSPLRLS RELESPAPMG LGTDSSHTLN EQNNMKQANW IPIAWETSLG  480
GPLGEVLHNP NSNTNAVEYK NNSSVLNLMT GGSWDNNNNS PSSLGSSPTG VLQKTAFGSL  540
SNSSAGSSPR AENNNKSHEG FSLCNDLLGS NMLNSSSLPA L*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009361143.10.0PREDICTED: growth-regulating factor 1-like
TrEMBLM5XR270.0M5XR27_PRUPE; Uncharacterized protein
STRINGVIT_18s0001g08650.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20853481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.13e-73growth-regulating factor 2